PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D10G2478
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 413aa    MW: 44708 Da    PI: 6.3521
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D10G2478genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.61.2e-1760105147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +g+W++eEd  l ++v+++G ++W++Iar ++ gR++k+c++rw + 
      Gh_D10G2478  60 KGPWSPEEDAVLSRLVAKFGARNWSLIARGIP-GRSGKSCRLRWCNQ 105
                      79******************************.***********985 PP

2Myb_DNA-binding56.65.9e-18112156147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r+++T eEd +++ a++ +G++ W++Ia+ ++ gRt++ +k++w++ 
      Gh_D10G2478 112 RKPFTDEEDRIIISAHAIHGNK-WASIAKLLP-GRTDNAIKNHWNST 156
                      789*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.34255106IPR017930Myb domain
SuperFamilySSF466895.39E-3158153IPR009057Homeodomain-like
SMARTSM007172.4E-1559108IPR001005SANT/Myb domain
PfamPF002497.0E-1760105IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-2661113IPR009057Homeodomain-like
CDDcd001671.22E-1462104No hitNo description
PROSITE profilePS5129426.922107161IPR017930Myb domain
SMARTSM007172.0E-17111159IPR001005SANT/Myb domain
PfamPF002495.5E-16112156IPR001005SANT/Myb domain
CDDcd001673.06E-13114157No hitNo description
Gene3DG3DSA:1.10.10.605.0E-24114160IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 413 aa     Download sequence    Send to blast
MEDEKESNRQ DSPAAGGSGS GSGGDELELI VAESELGGGG GSGVGGGGGS SSNNNNTRVK  60
GPWSPEEDAV LSRLVAKFGA RNWSLIARGI PGRSGKSCRL RWCNQLDPCL KRKPFTDEED  120
RIIISAHAIH GNKWASIAKL LPGRTDNAIK NHWNSTLRRR CMELGRFKPG PADTMEDGGF  180
ERTKASSEET LSVGDVNHFK HLEGRDMVMD DRPNLQEDKP PIQEDQFAIE PKNHPAVCRP  240
VARVSAFSRY NTPSSSKTES GMTSRIPVQG PLAQSSRPDW GVGKILEDLR CEPIIPLRCG  300
FGCCSTPCGG HSRTSLLGPE FVDFEEPHVF SSHELISIAT DLNNIAWIKS GLENSCVRIP  360
SNATSQRMSQ GSDIHTKSDP MCFTDGQSKL TGMSTEVLPT QTCTMRSEVE GLS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-40591606107B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.115592e-55boll| ovule| stem
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012455281.10.0PREDICTED: myb-like protein B
TrEMBLA0A0D2TEM90.0A0A0D2TEM9_G
STRINGVIT_13s0019g03200.t011e-142(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM56382747
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55730.11e-109myb domain protein 109